HMBS Antikörper (N-Term)

Produktnummer ABIN631916

Produktdetails anti-HMBS Antikörper

Target: HMBS (Hydroxymethylbilane Synthase (HMBS))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HMBS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HMBS antibody was raised against the N terminal of HMBS

Aufreinigung: Affinity purified

Immunogen: HMBS antibody was raised using the N terminal of HMBS corresponding to a region with amino acids MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HMBS Blocking Peptide, catalog no. 33R-6388, is also available for use as a blocking control in assays to test for specificity of this HMBS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMBS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HMBS

Target: HMBS (Hydroxymethylbilane Synthase (HMBS))

Andere Bezeichnung: HMBS (HMBS Produkte)

Hintergrund: HMBS is a member of the hydroxymethylbilane synthase superfamily. It is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria.

Molekulargewicht: 38 kDa (MW of target protein)