HMBS Antikörper (N-Term)

Produktnummer ABIN631916

Produktdetails anti-HMBS Antikörper

Target: HMBS (Hydroxymethylbilane Synthase (HMBS))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HMBS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HMBS antibody was raised against the N terminal of HMBS

Aufreinigung: Affinity purified

Immunogen: HMBS antibody was raised using the N terminal of HMBS corresponding to a region with amino acids MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HMBS Blocking Peptide, catalog no. 33R-6388, is also available for use as a blocking control in assays to test for specificity of this HMBS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMBS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HMBS

Target: HMBS (Hydroxymethylbilane Synthase (HMBS))

Andere Bezeichnung: HMBS (HMBS Produkte)

Synonyme: PBG-D antikoerper, PBGD antikoerper, PORC antikoerper, UPS antikoerper, URO-S antikoerper, hemC antikoerper, pbg-d antikoerper, pbgd antikoerper, ups antikoerper, SPAC806.01 antikoerper, DDBDRAFT_0186148 antikoerper, DDBDRAFT_0231417 antikoerper, DDB_0186148 antikoerper, DDB_0231417 antikoerper, Hmbs antikoerper, NV50236 antikoerper, T25658 antikoerper, Ups antikoerper, Uros1 antikoerper, hmbs antikoerper, zgc:64128 antikoerper, hmbsl antikoerper, id:ibd5004 antikoerper, im:7140060 antikoerper, zgc:110690 antikoerper, hydroxymethylbilane synthase antikoerper, hydroxymethylbilane synthase S homeolog antikoerper, hydroxymethylbilane synthase L homeolog antikoerper, hydroxymethylbilane synthase (predicted) antikoerper, Hydroxymethylbilane synthase antikoerper, hydroxymethylbilane synthase a antikoerper, hydroxymethylbilane synthase, b antikoerper, HMBS antikoerper, Hmbs antikoerper, hmbs antikoerper, hmbs.2.S antikoerper, hmbs.L antikoerper, CNC02250 antikoerper, hem3 antikoerper, hemC antikoerper, Trad_0335 antikoerper, Plabr_2100 antikoerper, Sgly_3113 antikoerper, SMLT_RS19660 antikoerper, PMI_RS16580 antikoerper, hmbsa antikoerper, hmbsb antikoerper

Hintergrund: HMBS is a member of the hydroxymethylbilane synthase superfamily. It is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria.

Molekulargewicht: 38 kDa (MW of target protein)