MVK Antikörper (N-Term)

Produktnummer ABIN631917

Produktdetails anti-MVK Antikörper

Target: MVK (Mevalonate Kinase (MVK))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MVK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MVK antibody was raised against the N terminal of MVK

Aufreinigung: Affinity purified

Immunogen: MVK antibody was raised using the N terminal of MVK corresponding to a region with amino acids LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MVK Blocking Peptide, catalog no. 33R-4807, is also available for use as a blocking control in assays to test for specificity of this MVK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MVK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MVK

Target: MVK (Mevalonate Kinase (MVK))

Andere Bezeichnung: MVK (MVK Produkte)

Synonyme: F21A20.160 antikoerper, F21A20_160 antikoerper, MEVALONATE KINASE antikoerper, MVK antikoerper, mevalonate kinase antikoerper, DDBDRAFT_0168621 antikoerper, DDBDRAFT_0302479 antikoerper, DDB_0168621 antikoerper, DDB_0302479 antikoerper, LRBP antikoerper, MK antikoerper, MVLK antikoerper, POROK3 antikoerper, 2310010A05Rik antikoerper, AI256848 antikoerper, AI414037 antikoerper, zgc:103473 antikoerper, mevalonate kinase antikoerper, mvk antikoerper, hypothetical protein antikoerper, MVK antikoerper, MK antikoerper, MA_RS03165 antikoerper, PAB_RS02890 antikoerper, LMOf2365_0011 antikoerper, mvk antikoerper, RCI_RS14145 antikoerper, TGAM_RS08735 antikoerper, MMAH_RS07705 antikoerper, TAGG_RS01605 antikoerper, SHELL_RS02965 antikoerper, MVOL_RS03085 antikoerper, Igag_1464 antikoerper, VDIS_RS11260 antikoerper, MFER_RS04560 antikoerper, DESMU_RS01555 antikoerper, ARCVE_RS02955 antikoerper, MZHIL_RS05110 antikoerper, Mvk antikoerper

Hintergrund: MVK is the peroxisomal enzyme mevalonate kinase. Mevalonate is a key intermediate, and mevalonate kinase a key early enzyme, in isoprenoid and sterol synthesis. Mevalonate kinase deficiency caused by mutation of this gene results in mevalonic aciduria, a disease characterized psychomotor retardation, failure to thrive, hepatosplenomegaly, anemia and recurrent febrile crises. Defects in this gene also cause hyperimmunoglobulinaemia D and periodic fever syndrome, a disorder characterized by recurrent episodes of fever associated with lymphadenopathy, arthralgia, gastrointestinal dismay and skin rash.

Molekulargewicht: 42 kDa (MW of target protein)