Pellino 3 Antikörper
-
- Target Alle Pellino 3 (PELI3) Antikörper anzeigen
- Pellino 3 (PELI3) (Pellino E3 Ubiquitin Protein Ligase Family Member 3 (PELI3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Pellino 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PELI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG
- Top Product
- Discover our top product PELI3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PELI3 Blocking Peptide, catalog no. 33R-9650, is also available for use as a blocking control in assays to test for specificity of this PELI3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PELI3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Pellino 3 (PELI3) (Pellino E3 Ubiquitin Protein Ligase Family Member 3 (PELI3))
- Andere Bezeichnung
- PELI3 (PELI3 Produkte)
- Synonyme
- 6030441F14Rik antikoerper, A930011L17 antikoerper, BC028931 antikoerper, RGD1305989 antikoerper, pellino 3 antikoerper, pellino E3 ubiquitin protein ligase family member 3 antikoerper, Peli3 antikoerper, PELI3 antikoerper
- Hintergrund
- Toll-like receptors (TLRs) and IL1R (IL1R1) are part of the innate immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in the signaling cascades initiated by TLRs and IL1R.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- Toll-Like Receptors Cascades
-