ENOSF1 Antikörper (N-Term)

Produktnummer ABIN631927

Produktdetails anti-ENOSF1 Antikörper

Target: ENOSF1 (Enolase Superfamily Member 1 (ENOSF1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ENOSF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ENOSF1 antibody was raised against the N terminal of ENOSF1

Aufreinigung: Affinity purified

Immunogen: ENOSF1 antibody was raised using the N terminal of ENOSF1 corresponding to a region with amino acids MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ENOSF1 Blocking Peptide, catalog no. 33R-6601, is also available for use as a blocking control in assays to test for specificity of this ENOSF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENOSF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ENOSF1

Target: ENOSF1 (Enolase Superfamily Member 1 (ENOSF1))

Andere Bezeichnung: ENOSF1 (ENOSF1 Produkte)

Synonyme: HSRTSBETA antikoerper, RTS antikoerper, TYMSAS antikoerper, enolase superfamily member 1 antikoerper, enolase superfamily member 1 S homeolog antikoerper, ENOSF1 antikoerper, enosf1.S antikoerper

Hintergrund: This gene was originally identified as a naturally occurring antisense transcript to the human thymidylate synthase gene. Alternate splice variants have been described.

Molekulargewicht: 50 kDa (MW of target protein)