LRRC50 Antikörper (N-Term)
-
- Target Alle LRRC50 Antikörper anzeigen
- LRRC50 (Leucine Rich Repeat Containing 50 (LRRC50))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LRRC50 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LRRC50 antibody was raised against the N terminal of LRRC50
- Aufreinigung
- Affinity purified
- Immunogen
- LRRC50 antibody was raised using the N terminal of LRRC50 corresponding to a region with amino acids LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLF
- Top Product
- Discover our top product LRRC50 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LRRC50 Blocking Peptide, catalog no. 33R-5219, is also available for use as a blocking control in assays to test for specificity of this LRRC50 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC50 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRC50 (Leucine Rich Repeat Containing 50 (LRRC50))
- Andere Bezeichnung
- LRRC50 (LRRC50 Produkte)
- Hintergrund
- LRRC50 contains 6 LRR (leucine-rich) repeats. It is proposed that LRRC50 to be a novel candidate gene for human cystic kidney disease, involved in regulation of microtubule-based cilia and actin-based brush border microvilli.
- Molekulargewicht
- 80 kDa (MW of target protein)
-