ICA1 Antikörper (N-Term)

Produktnummer ABIN631932

Produktdetails anti-ICA1 Antikörper

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ICA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ICA1 antibody was raised against the N terminal of ICA1

Aufreinigung: Affinity purified

Immunogen: ICA1 antibody was raised using the N terminal of ICA1 corresponding to a region with amino acids SKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ICA1 Blocking Peptide, catalog no. 33R-8545, is also available for use as a blocking control in assays to test for specificity of this ICA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ICA1

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Andere Bezeichnung: ICA1 (ICA1 Produkte)

Synonyme: ica1 antikoerper, MGC52730 antikoerper, ICA1 antikoerper, DKFZp469G0321 antikoerper, zgc:92566 antikoerper, 69kDa antikoerper, ICA69 antikoerper, Ica69 antikoerper, MGC83241 antikoerper, ICAp69 antikoerper, islet cell autoantigen 1 L homeolog antikoerper, islet cell autoantigen 1 antikoerper, Islet cell autoantigen 1 antikoerper, islet cell autoantigen 1 S homeolog antikoerper, ica1.L antikoerper, ICA1 antikoerper, ica1 antikoerper, ica69 antikoerper, Ica1 antikoerper, ica1.S antikoerper

Hintergrund: ICA1 is a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome.

Molekulargewicht: 55 kDa (MW of target protein)