FAM92B Antikörper (N-Term)

Produktnummer ABIN631935

Produktdetails anti-FAM92B Antikörper

Target: FAM92B (Family with Sequence Similarity 92, Member B (FAM92B))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM92B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM92 B antibody was raised against the N terminal of FAM92

Aufreinigung: Affinity purified

Immunogen: FAM92 B antibody was raised using the N terminal of FAM92 corresponding to a region with amino acids FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM92B Blocking Peptide, catalog no. 33R-2839, is also available for use as a blocking control in assays to test for specificity of this FAM92B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM90 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM92B

Target: FAM92B (Family with Sequence Similarity 92, Member B (FAM92B))

Andere Bezeichnung: FAM92B (FAM92B Produkte)

Synonyme: 1700120B06Rik antikoerper, RGD1560673 antikoerper, family with sequence similarity 92 member B antikoerper, family with sequence similarity 92, member B antikoerper, FAM92B antikoerper, Fam92b antikoerper

Hintergrund: The function of FAM92 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 35 kDa (MW of target protein)