PRAMEF10 Antikörper (Middle Region)
-
- Target Alle PRAMEF10 Produkte
- PRAMEF10 (PRAME Family Member 10 (PRAMEF10))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRAMEF10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRAMEF10 antibody was raised against the middle region of PRAMEF10
- Aufreinigung
- Affinity purified
- Immunogen
- PRAMEF10 antibody was raised using the middle region of PRAMEF10 corresponding to a region with amino acids DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRAMEF10 Blocking Peptide, catalog no. 33R-2057, is also available for use as a blocking control in assays to test for specificity of this PRAMEF10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRAMEF10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRAMEF10 (PRAME Family Member 10 (PRAMEF10))
- Andere Bezeichnung
- PRAMEF10 (PRAMEF10 Produkte)
- Synonyme
- RP5-845O24.7 antikoerper, PRAME family member 10 antikoerper, PRAMEF10 antikoerper
- Hintergrund
- PRAMEF10 belongs to the PRAME family. It contains 3 LRR (leucine-rich) repeats. The function of the PRAMEF10 protein remains unknown.
- Molekulargewicht
- 55 kDa (MW of target protein)
-