FKBPL Antikörper (N-Term)

Produktnummer ABIN631941

Produktdetails anti-FKBPL Antikörper

Target: FKBPL (FK506 Binding Protein Like (FKBPL))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FKBPL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FKBPL antibody was raised against the N terminal of FKBPL

Aufreinigung: Affinity purified

Immunogen: FKBPL antibody was raised using the N terminal of FKBPL corresponding to a region with amino acids METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FKBPL Blocking Peptide, catalog no. 33R-5971, is also available for use as a blocking control in assays to test for specificity of this FKBPL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBPL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FKBPL

Target: FKBPL (FK506 Binding Protein Like (FKBPL))

Andere Bezeichnung: FKBPL (FKBPL Produkte)

Synonyme: FKBPL antikoerper, ng7 antikoerper, dir1 antikoerper, wisp39 antikoerper, DIR1 antikoerper, NG7 antikoerper, WISP39 antikoerper, Ppiase-X antikoerper, Wisp39 antikoerper, FK506 binding protein like antikoerper, FK506 binding protein-like antikoerper, FKBPL antikoerper, fkbpl antikoerper, Fkbpl antikoerper

Hintergrund: The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking.

Molekulargewicht: 38 kDa (MW of target protein)