GSG1 Antikörper (N-Term)

Produktnummer ABIN631943

Produktdetails anti-GSG1 Antikörper

Target: GSG1 (Germ Cell Associated 1 (GSG1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GSG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GSG1 antibody was raised against the N terminal of GSG1

Aufreinigung: Affinity purified

Immunogen: GSG1 antibody was raised using the N terminal of GSG1 corresponding to a region with amino acids NYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GSG1 Blocking Peptide, catalog no. 33R-6947, is also available for use as a blocking control in assays to test for specificity of this GSG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GSG1

Target: GSG1 (Germ Cell Associated 1 (GSG1))

Andere Bezeichnung: GSG1 (GSG1 Produkte)

Synonyme: germ cell associated 1 antikoerper, GSG1 antikoerper, Gsg1 antikoerper

Hintergrund: GSG1 belongs to the GSG1 family. GSG1 may cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum.

Molekulargewicht: 41 kDa (MW of target protein)