GPR87 Antikörper (Middle Region)
-
- Target Alle GPR87 Antikörper anzeigen
- GPR87 (G Protein-Coupled Receptor 87 (GPR87))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GPR87 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GPR87 antibody was raised against the middle region of GPR87
- Aufreinigung
- Affinity purified
- Immunogen
- GPR87 antibody was raised using the middle region of GPR87 corresponding to a region with amino acids NQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL
- Top Product
- Discover our top product GPR87 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GPR87 Blocking Peptide, catalog no. 33R-6845, is also available for use as a blocking control in assays to test for specificity of this GPR87 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR87 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPR87 (G Protein-Coupled Receptor 87 (GPR87))
- Andere Bezeichnung
- GPR87 (GPR87 Produkte)
- Synonyme
- GPR95 antikoerper, KPG_002 antikoerper, G protein-coupled receptor 87 antikoerper, GPR87 antikoerper, Gpr87 antikoerper
- Hintergrund
- G protein-coupled receptors play a role in cell communication. They are characterized by an extracellular N terminus, 7 transmembrane regions, and an intracellular C terminus.
- Molekulargewicht
- 41 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-