ANKRD2 Antikörper
-
- Target Alle ANKRD2 Antikörper anzeigen
- ANKRD2 (Ankyrin Repeat Domain 2 (Stretch Responsive Muscle) (ANKRD2))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ANKRD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ANKRD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL
- Top Product
- Discover our top product ANKRD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ANKRD2 Blocking Peptide, catalog no. 33R-7516, is also available for use as a blocking control in assays to test for specificity of this ANKRD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ANKRD2 (Ankyrin Repeat Domain 2 (Stretch Responsive Muscle) (ANKRD2))
- Andere Bezeichnung
- ANKRD2 (ANKRD2 Produkte)
- Hintergrund
- ANKRD2 may play an important role in skeletal muscle hypertrophy.
- Molekulargewicht
- 49 kDa (MW of target protein)
-