FBP2 Antikörper (Middle Region)
-
- Target Alle FBP2 Antikörper anzeigen
- FBP2 (Fructose-1,6-Bisphosphatase 2 (FBP2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FBP2 antibody was raised against the middle region of FBP2
- Aufreinigung
- Affinity purified
- Immunogen
- FBP2 antibody was raised using the middle region of FBP2 corresponding to a region with amino acids YIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ
- Top Product
- Discover our top product FBP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBP2 Blocking Peptide, catalog no. 33R-10138, is also available for use as a blocking control in assays to test for specificity of this FBP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBP2 (Fructose-1,6-Bisphosphatase 2 (FBP2))
- Andere Bezeichnung
- FBP2 (FBP2 Produkte)
- Synonyme
- 6330409F21Rik antikoerper, Fbp2 antikoerper, Fubp2 antikoerper, Ksrp antikoerper, Fbp-1 antikoerper, Fbp1 antikoerper, Rae-30 antikoerper, FBPase antikoerper, zgc:101083 antikoerper, FBP2 antikoerper, MGC108013 antikoerper, FBP antikoerper, fructose-bisphosphatase 2 antikoerper, KH-type splicing regulatory protein antikoerper, fructose bisphosphatase 2 antikoerper, fructose-1,6-bisphosphatase 2 antikoerper, fructose-bisphosphatase 2 L homeolog antikoerper, FBP2 antikoerper, Khsrp antikoerper, Fbp2 antikoerper, fbp2 antikoerper, fbp2.L antikoerper
- Hintergrund
- FBP2 is a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate.
- Molekulargewicht
- 37 kDa (MW of target protein)
-