ADH5 Antikörper
-
- Target Alle ADH5 Antikörper anzeigen
- ADH5 (Alcohol Dehydrogenase 5 (Class III), chi Polypeptide (ADH5))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADH5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ADH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVV
- Top Product
- Discover our top product ADH5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADH5 Blocking Peptide, catalog no. 33R-4667, is also available for use as a blocking control in assays to test for specificity of this ADH5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADH5 (Alcohol Dehydrogenase 5 (Class III), chi Polypeptide (ADH5))
- Andere Bezeichnung
- ADH5 (ADH5 Produkte)
- Synonyme
- ADH2 antikoerper, ADH-3 antikoerper, ADHX antikoerper, FALDH antikoerper, FDH antikoerper, GSH-FDH antikoerper, GSNOR antikoerper, ADH1C antikoerper, ADH3 antikoerper, wu:fb60b11 antikoerper, Adh-5 antikoerper, Adh3 antikoerper, adh-3 antikoerper, adh3 antikoerper, adh5 antikoerper, adhx antikoerper, fdh antikoerper, gsnor antikoerper, ADH4 antikoerper, ADH5 antikoerper, alcohol dehydrogenase 1B (class I), beta polypeptide antikoerper, alcohol dehydrogenase 5 (class III), chi polypeptide antikoerper, alcohol dehydrogenase 5 antikoerper, alcohol dehydrogenase 5 (class III), chi polypeptide L homeolog antikoerper, alcohol dehydrogenase class-3 antikoerper, ADH1B antikoerper, ADH5 antikoerper, adh5 antikoerper, Adh5 antikoerper, adh5.L antikoerper, LOC101112223 antikoerper
- Hintergrund
- This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene.
- Molekulargewicht
- 40 kDa (MW of target protein)
-