FBP2 Antikörper (Middle Region)

Produktnummer ABIN631962

Produktdetails anti-FBP2 Antikörper

Target: FBP2 (Fructose-1,6-Bisphosphatase 2 (FBP2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBP2 antibody was raised against the middle region of FBP2

Aufreinigung: Affinity purified

Immunogen: FBP2 antibody was raised using the middle region of FBP2 corresponding to a region with amino acids YAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBP2 Blocking Peptide, catalog no. 33R-10051, is also available for use as a blocking control in assays to test for specificity of this FBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBP2

Target: FBP2 (Fructose-1,6-Bisphosphatase 2 (FBP2))

Andere Bezeichnung: FBP2 (FBP2 Produkte)

Synonyme: 6330409F21Rik antikoerper, Fbp2 antikoerper, Fubp2 antikoerper, Ksrp antikoerper, Fbp-1 antikoerper, Fbp1 antikoerper, Rae-30 antikoerper, FBPase antikoerper, zgc:101083 antikoerper, FBP2 antikoerper, MGC108013 antikoerper, FBP antikoerper, fructose-bisphosphatase 2 antikoerper, KH-type splicing regulatory protein antikoerper, fructose bisphosphatase 2 antikoerper, fructose-1,6-bisphosphatase 2 antikoerper, fructose-bisphosphatase 2 L homeolog antikoerper, FBP2 antikoerper, Khsrp antikoerper, Fbp2 antikoerper, fbp2 antikoerper, fbp2.L antikoerper

Hintergrund: FBP2 is a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate.

Molekulargewicht: 37 kDa (MW of target protein)