SOHLH1 Antikörper (Middle Region)
-
- Target Alle SOHLH1 Antikörper anzeigen
- SOHLH1 (Spermatogenesis and Oogenesis Specific Basic Helix-Loop-Helix 1 (SOHLH1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SOHLH1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SOHLH1 antibody was raised against the middle region of SOHLH1
- Aufreinigung
- Affinity purified
- Immunogen
- SOHLH1 antibody was raised using the middle region of SOHLH1 corresponding to a region with amino acids EAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLT
- Top Product
- Discover our top product SOHLH1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SOHLH1 Blocking Peptide, catalog no. 33R-2251, is also available for use as a blocking control in assays to test for specificity of this SOHLH1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOHLH1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SOHLH1 (Spermatogenesis and Oogenesis Specific Basic Helix-Loop-Helix 1 (SOHLH1))
- Andere Bezeichnung
- SOHLH1 (SOHLH1 Produkte)
- Synonyme
- C9orf157 antikoerper, NOHLH antikoerper, SPATA27 antikoerper, TEB2 antikoerper, bA100C15.3 antikoerper, bHLHe80 antikoerper, Gm110 antikoerper, Nohlh antikoerper, RGD1564440 antikoerper, spermatogenesis and oogenesis specific basic helix-loop-helix 1 antikoerper, SOHLH1 antikoerper, Sohlh1 antikoerper
- Hintergrund
- SOHLH1 contains 1 basic helix-loop-helix (bHLH) domain. It is a probable transcription factor required during spermatogenesis and oogenesis.
- Molekulargewicht
- 42 kDa (MW of target protein)
-