RWDD4A Antikörper (Middle Region)

Produktnummer ABIN631971

Produktdetails anti-RWDD4A Antikörper

Target: RWDD4A (RWDD4) (RWD Domain Containing 4 (RWDD4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RWDD4A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RWDD4 A antibody was raised against the middle region of RWDD4

Aufreinigung: Affinity purified

Immunogen: RWDD4 A antibody was raised using the middle region of RWDD4 corresponding to a region with amino acids SSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLSKTGSKDD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RWDD4A Blocking Peptide, catalog no. 33R-8816, is also available for use as a blocking control in assays to test for specificity of this RWDD4A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RWDD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RWDD4A

Target: RWDD4A (RWDD4) (RWD Domain Containing 4 (RWDD4))

Andere Bezeichnung: RWDD4A (RWDD4 Produkte)

Synonyme: BC016198 antikoerper, Gm1942 antikoerper, Rwdd4 antikoerper, FAM28A antikoerper, RWDD4A antikoerper, fam28a antikoerper, rwdd4a antikoerper, Rwdd4a antikoerper, si:ch211-192e21.1 antikoerper, zgc:103545 antikoerper, RWD domain containing 4A antikoerper, RWD domain containing 4 antikoerper, RWD domain containing 4 L homeolog antikoerper, Rwdd4a antikoerper, RWDD4 antikoerper, rwdd4.L antikoerper, Rwdd4 antikoerper, rwdd antikoerper

Hintergrund: The function of RWDD4 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 21 kDa (MW of target protein)