NHLRC2 Antikörper (N-Term)

Produktnummer ABIN631979

Produktdetails anti-NHLRC2 Antikörper

Target: NHLRC2 (NHL Repeat Containing 2 (NHLRC2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NHLRC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NHLRC2 antibody was raised against the N terminal of NHLRC2

Aufreinigung: Affinity purified

Immunogen: NHLRC2 antibody was raised using the N terminal of NHLRC2 corresponding to a region with amino acids YSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NHLRC2 Blocking Peptide, catalog no. 33R-10237, is also available for use as a blocking control in assays to test for specificity of this NHLRC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NHLRC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NHLRC2

Target: NHLRC2 (NHL Repeat Containing 2 (NHLRC2))

Andere Bezeichnung: NHLRC2 (NHLRC2 Produkte)

Synonyme: 1200003G01Rik antikoerper, AI835049 antikoerper, AV002846 antikoerper, AW496455 antikoerper, NHL repeat containing 2 antikoerper, NHLRC2 antikoerper, Nhlrc2 antikoerper

Hintergrund: The function of NHLRC2 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 79 kDa (MW of target protein)