RSPH10B Antikörper

Produktnummer ABIN631980

Produktdetails anti-RSPH10B Antikörper

Target: RSPH10B (Radial Spoke Head 10 Homolog B (RSPH10B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RSPH10B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RSPH10 B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RSPH10B Blocking Peptide, catalog no. 33R-2414, is also available for use as a blocking control in assays to test for specificity of this RSPH10B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSPH10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RSPH10B

Target: RSPH10B (Radial Spoke Head 10 Homolog B (RSPH10B))

Andere Bezeichnung: RSPH10B (RSPH10B Produkte)

Synonyme: RSPH10B2 antikoerper, RGD1311893 antikoerper, radial spoke head 10 homolog B antikoerper, radial spoke head 10 homolog B (Chlamydomonas) antikoerper, RSPH10B antikoerper, Rsph10b antikoerper

Hintergrund: The function of RSPH10B protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 96 kDa (MW of target protein)