MTHFD2L Antikörper

Produktnummer ABIN631982

Produktdetails anti-MTHFD2L Antikörper

Target: MTHFD2L (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2-Like (MTHFD2L))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTHFD2L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: MTHFD2 L antibody was raised using a synthetic peptide corresponding to a region with amino acids TGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTHFD2L Blocking Peptide, catalog no. 33R-9087, is also available for use as a blocking control in assays to test for specificity of this MTHFD2L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTHFD2L

Target: MTHFD2L (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2-Like (MTHFD2L))

Andere Bezeichnung: MTHFD2L (MTHFD2L Produkte)

Synonyme: wu:fi14c12 antikoerper, zgc:63479 antikoerper, 1110019K23Rik antikoerper, C630010D07Rik antikoerper, RGD1310879 antikoerper, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2 like antikoerper, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like antikoerper, MTHFD2L antikoerper, mthfd2l antikoerper, Mthfd2l antikoerper

Hintergrund: The function of MTHFD2L protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 37 kDa (MW of target protein)