FANCL Antikörper (Middle Region)
-
- Target Alle FANCL Antikörper anzeigen
- FANCL (Fanconi Anemia, Complementation Group L (FANCL))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FANCL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FANCL antibody was raised against the middle region of FANCL
- Aufreinigung
- Affinity purified
- Immunogen
- FANCL antibody was raised using the middle region of FANCL corresponding to a region with amino acids ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY
- Top Product
- Discover our top product FANCL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FANCL Blocking Peptide, catalog no. 33R-1506, is also available for use as a blocking control in assays to test for specificity of this FANCL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FANCL (Fanconi Anemia, Complementation Group L (FANCL))
- Andere Bezeichnung
- FANCL (FANCL Produkte)
- Synonyme
- FAAP43 antikoerper, PHF9 antikoerper, POG antikoerper, 2010322C19Rik antikoerper, AW554273 antikoerper, B230118H11Rik antikoerper, Phf9 antikoerper, Pog antikoerper, gcd antikoerper, Fanconi anemia complementation group L antikoerper, Fanconi anemia, complementation group L antikoerper, FANCL antikoerper, Fancl antikoerper
- Hintergrund
- The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.
- Molekulargewicht
- 42 kDa (MW of target protein)
- Pathways
- DNA Reparatur
-