PRR16 Antikörper (Middle Region)

Produktnummer ABIN631986

Produktdetails anti-PRR16 Antikörper

Target: PRR16 (Proline Rich 16 (PRR16))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRR16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRR16 antibody was raised against the middle region of PRR16

Aufreinigung: Affinity purified

Immunogen: PRR16 antibody was raised using the middle region of PRR16 corresponding to a region with amino acids RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRR16 Blocking Peptide, catalog no. 33R-7888, is also available for use as a blocking control in assays to test for specificity of this PRR16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRR16

Target: PRR16 (Proline Rich 16 (PRR16))

Andere Bezeichnung: PRR16 (PRR16 Produkte)

Synonyme: DSC54 antikoerper, 5430406M13Rik antikoerper, AI607429 antikoerper, RGD1564528 antikoerper, proline rich 16 antikoerper, PRR16 antikoerper, prr16 antikoerper, Prr16 antikoerper

Hintergrund: The function of PRR16 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 30 kDa (MW of target protein)