BRIX1 Antikörper (Middle Region)
-
- Target Alle BRIX1 Antikörper anzeigen
- BRIX1 (BRX1, Biogenesis of Ribosomes, Homolog (BRIX1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BRIX1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BXDC2 antibody was raised against the middle region of Bxdc2
- Aufreinigung
- Affinity purified
- Immunogen
- BXDC2 antibody was raised using the middle region of Bxdc2 corresponding to a region with amino acids ALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAA
- Top Product
- Discover our top product BRIX1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BXDC2 Blocking Peptide, catalog no. 33R-1351, is also available for use as a blocking control in assays to test for specificity of this BXDC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BXDC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BRIX1 (BRX1, Biogenesis of Ribosomes, Homolog (BRIX1))
- Andere Bezeichnung
- BXDC2 (BRIX1 Produkte)
- Synonyme
- BXDC2 antikoerper, brix antikoerper, bxdc2 antikoerper, BRIX antikoerper, 1110064N10Rik antikoerper, Bxdc2 antikoerper, C76935 antikoerper, RGD1308508 antikoerper, BRX1, biogenesis of ribosomes antikoerper, BRX1, biogenesis of ribosomes S homeolog antikoerper, BRIX1 antikoerper, brix1.S antikoerper, Brix1 antikoerper
- Hintergrund
- BXDC2 is required for biogenesis of the 60S ribosomal subunit.
- Molekulargewicht
- 41 kDa (MW of target protein)
-