EXD3 Antikörper (N-Term)

Produktnummer ABIN631991

Produktdetails anti-EXD3 Antikörper

Target: EXD3 (Exonuclease 3'-5' Domain Containing 3 (EXD3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EXD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FLJ20433 antibody was raised against the N terminal of FLJ20433

Aufreinigung: Affinity purified

Immunogen: FLJ20433 antibody was raised using the N terminal of FLJ20433 corresponding to a region with amino acids MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLJ20433 Blocking Peptide, catalog no. 33R-6053, is also available for use as a blocking control in assays to test for specificity of this FLJ20433 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ20433 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EXD3

Target: EXD3 (Exonuclease 3'-5' Domain Containing 3 (EXD3))

Abstract: EXD3 Produkte

Synonyme: mut-7 antikoerper, exonuclease 3'-5' domain containing 3 antikoerper, Exonuclease mut-7 antikoerper, EXD3 antikoerper, mut-7 antikoerper

Hintergrund: The specific function of FLJ20433 is not yet known.

Molekulargewicht: 83 kDa (MW of target protein)