SPAG6 Antikörper (Middle Region)
-
- Target Alle SPAG6 Antikörper anzeigen
- SPAG6 (Sperm Associated Antigen 6 (SPAG6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SPAG6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SPAG6 antibody was raised against the middle region of SPAG6
- Aufreinigung
- Affinity purified
- Immunogen
- SPAG6 antibody was raised using the middle region of SPAG6 corresponding to a region with amino acids HVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSC
- Top Product
- Discover our top product SPAG6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SPAG6 Blocking Peptide, catalog no. 33R-3872, is also available for use as a blocking control in assays to test for specificity of this SPAG6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPAG6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPAG6 (Sperm Associated Antigen 6 (SPAG6))
- Andere Bezeichnung
- SPAG6 (SPAG6 Produkte)
- Synonyme
- Repro-SA-1 antikoerper, pf16 antikoerper, PF16 antikoerper, RGD1310892 antikoerper, zgc:91805 antikoerper, SPAG6 antikoerper, repro-sa-1 antikoerper, DKFZp459D035 antikoerper, sperm associated antigen 6 antikoerper, sperm associated antigen 6-like antikoerper, sperm associated antigen 6 L homeolog antikoerper, SPAG6 antikoerper, Spag6l antikoerper, Spag6 antikoerper, spag6 antikoerper, spag6.L antikoerper
- Hintergrund
- SPAG6 is important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.
- Molekulargewicht
- 56 kDa (MW of target protein)
-