PSG6 Antikörper (N-Term)
-
- Target Alle PSG6 Antikörper anzeigen
- PSG6 (Pregnancy Specific beta-1-Glycoprotein 6 (PSG6))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PSG6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PSG6 antibody was raised against the N terminal of PSG6
- Aufreinigung
- Affinity purified
- Immunogen
- PSG6 antibody was raised using the N terminal of PSG6 corresponding to a region with amino acids VLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETV
- Top Product
- Discover our top product PSG6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PSG6 Blocking Peptide, catalog no. 33R-9675, is also available for use as a blocking control in assays to test for specificity of this PSG6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSG6 (Pregnancy Specific beta-1-Glycoprotein 6 (PSG6))
- Andere Bezeichnung
- PSG6 (PSG6 Produkte)
- Synonyme
- PSBG-10 antikoerper, PSBG-12 antikoerper, PSBG-6 antikoerper, PSG10 antikoerper, PSGGB antikoerper, PSG6 antikoerper, PSG3 antikoerper, pregnancy specific beta-1-glycoprotein 6 antikoerper, pregnancy-specific beta-1-glycoprotein 4 antikoerper, PSG6 antikoerper, LOC456082 antikoerper
- Hintergrund
- PSG6 may have a role in modulation of the innate immune system.
- Molekulargewicht
- 47 kDa (MW of target protein)
-