FBXO39 Antikörper (N-Term)

Produktnummer ABIN632003

Produktdetails anti-FBXO39 Antikörper

Target: FBXO39 (F-Box Protein 39 (FBXO39))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXO39 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXO39 antibody was raised against the N terminal of FBXO39

Aufreinigung: Affinity purified

Immunogen: FBXO39 antibody was raised using the N terminal of FBXO39 corresponding to a region with amino acids DRSRAALVCRKWNQMMYSAELWRYRTITFSGRPSRVHASEVESAVWYVKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXO39 Blocking Peptide, catalog no. 33R-2151, is also available for use as a blocking control in assays to test for specificity of this FBXO39 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO39 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXO39

Target: FBXO39 (F-Box Protein 39 (FBXO39))

Andere Bezeichnung: FBXO39 (FBXO39 Produkte)

Synonyme: Fbx39 antikoerper, 1700010H23Rik antikoerper, F-box protein 39 antikoerper, FBXO39 antikoerper, Fbxo39 antikoerper

Hintergrund: FBXO39 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO39, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molekulargewicht: 53 kDa (MW of target protein)