Dystrobrevin beta Antikörper (C-Term)
-
- Target Alle Dystrobrevin beta (DTNB) Antikörper anzeigen
- Dystrobrevin beta (DTNB) (Dystrobrevin, beta (DTNB))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Dystrobrevin beta Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DTNB antibody was raised against the C terminal of DTNB
- Aufreinigung
- Affinity purified
- Immunogen
- DTNB antibody was raised using the C terminal of DTNB corresponding to a region with amino acids ASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEEL
- Top Product
- Discover our top product DTNB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DTNB Blocking Peptide, catalog no. 33R-1524, is also available for use as a blocking control in assays to test for specificity of this DTNB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DTNB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Dystrobrevin beta (DTNB) (Dystrobrevin, beta (DTNB))
- Andere Bezeichnung
- DTNB (DTNB Produkte)
- Hintergrund
- DTNB is dystrobrevin beta, a component of the dystrophin-associated protein complex (DPC). The DPC consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and dystrobrevin alpha and beta. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Dystrobrevin beta is thought to interact with syntrophin and the DP71 short form of dystrophin.
- Molekulargewicht
- 64 kDa (MW of target protein)
-