UCK2 Antikörper (N-Term)

Produktnummer ABIN632007

Produktdetails anti-UCK2 Antikörper

Target: UCK2 (Uridine-Cytidine Kinase 2 (UCK2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UCK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UCK2 antibody was raised against the N terminal of UCK2

Aufreinigung: Affinity purified

Immunogen: UCK2 antibody was raised using the N terminal of UCK2 corresponding to a region with amino acids AGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UCK2 Blocking Peptide, catalog no. 33R-1189, is also available for use as a blocking control in assays to test for specificity of this UCK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UCK2

Target: UCK2 (Uridine-Cytidine Kinase 2 (UCK2))

Andere Bezeichnung: UCK2 (UCK2 Produkte)

Hintergrund: UCK2 catalyzes the phosphorylation of uridine monophosphate to uridine diphosphate. This is the first step in the production of the pyrimidine nucleoside triphosphates required for RNA and DNA synthesis. In addition, an allele of this gene may play a role in mediating nonhumoral immunity to Hemophilus influenzae type B.

Molekulargewicht: 29 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Feeding Behaviour