UCK2 Antikörper (N-Term)

Produktnummer ABIN632007

Produktdetails anti-UCK2 Antikörper

Target: UCK2 (Uridine-Cytidine Kinase 2 (UCK2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UCK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UCK2 antibody was raised against the N terminal of UCK2

Aufreinigung: Affinity purified

Immunogen: UCK2 antibody was raised using the N terminal of UCK2 corresponding to a region with amino acids AGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UCK2 Blocking Peptide, catalog no. 33R-1189, is also available for use as a blocking control in assays to test for specificity of this UCK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UCK2

Target: UCK2 (Uridine-Cytidine Kinase 2 (UCK2))

Andere Bezeichnung: UCK2 (UCK2 Produkte)

Synonyme: TSA903 antikoerper, UK antikoerper, UMPK antikoerper, AA407809 antikoerper, AI481316 antikoerper, AU018180 antikoerper, AU020720 antikoerper, UMK antikoerper, Umpk antikoerper, wu:fa20g04 antikoerper, zgc:56174 antikoerper, UCK2 antikoerper, DDBDRAFT_0202355 antikoerper, DDBDRAFT_0216233 antikoerper, DDB_0202355 antikoerper, DDB_0216233 antikoerper, DDBDRAFT_0167798 antikoerper, DDBDRAFT_0230208 antikoerper, DDB_0167798 antikoerper, DDB_0230208 antikoerper, UCK 2-A antikoerper, umpk antikoerper, wu:fk91a01 antikoerper, zgc:66240 antikoerper, uridine-cytidine kinase 2 antikoerper, uridine-cytidine kinase 2b antikoerper, microRNA 3658 antikoerper, uridine-cytidine kinase 2 S homeolog antikoerper, uridine kinase antikoerper, Uridine kinase antikoerper, toxin secretion ABC transporter ATP-binding protein antikoerper, uridine-cytidine kinase 2a antikoerper, UCK2 antikoerper, Uck2 antikoerper, uck2b antikoerper, MIR3658 antikoerper, uck2.S antikoerper, LOC692983 antikoerper, PTRG_08949 antikoerper, udkA antikoerper, udkB antikoerper, Mrub_2364 antikoerper, Mesil_2200 antikoerper, Spirs_2239 antikoerper, Tmar_0146 antikoerper, Bache_3005 antikoerper, Celal_2781 antikoerper, Deima_0461 antikoerper, Odosp_0439 antikoerper, Bacsa_1376 antikoerper, Celly_0243 antikoerper, Weevi_1813 antikoerper, Marky_0973 antikoerper, Spico_0967 antikoerper, Poras_0295 antikoerper, Theth_1915 antikoerper, uck2 antikoerper, XCC1480 antikoerper, uck2a antikoerper

Hintergrund: UCK2 catalyzes the phosphorylation of uridine monophosphate to uridine diphosphate. This is the first step in the production of the pyrimidine nucleoside triphosphates required for RNA and DNA synthesis. In addition, an allele of this gene may play a role in mediating nonhumoral immunity to Hemophilus influenzae type B.

Molekulargewicht: 29 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Feeding Behaviour