FAM29A Antikörper (Middle Region)

Produktnummer ABIN632011

Produktdetails anti-FAM29A Antikörper

Target: FAM29A (HAUS6) (HAUS Augmin-Like Complex, Subunit 6 (HAUS6))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM29A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM29 A antibody was raised against the middle region of Fam29

Aufreinigung: Affinity purified

Immunogen: FAM29 A antibody was raised using the middle region of Fam29 corresponding to a region with amino acids RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM29A Blocking Peptide, catalog no. 33R-8198, is also available for use as a blocking control in assays to test for specificity of this FAM29A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM29A

Target: FAM29A (HAUS6) (HAUS Augmin-Like Complex, Subunit 6 (HAUS6))

Andere Bezeichnung: FAM29A (HAUS6 Produkte)

Synonyme: Dgt6 antikoerper, FAM29A antikoerper, fam29a antikoerper, wu:fd21a02 antikoerper, zgc:153242 antikoerper, family with sequence similarity 29, member A antikoerper, HAUS augmin like complex subunit 6 antikoerper, HAUS augmin-like complex, subunit 6 antikoerper, Fam29a antikoerper, HAUS6 antikoerper, haus6 antikoerper

Hintergrund: FAM29A is required for progression through mitosis. FAM29A promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-tubulin.

Molekulargewicht: 108 kDa (MW of target protein)