ALAD Antikörper (N-Term)

Produktnummer ABIN632018

Produktdetails anti-ALAD Antikörper

Target: ALAD (Aminolevulinate Dehydratase (ALAD))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALAD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ALAD antibody was raised against the N terminal of ALAD

Aufreinigung: Affinity purified

Immunogen: ALAD antibody was raised using the N terminal of ALAD corresponding to a region with amino acids EEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKT

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALAD Blocking Peptide, catalog no. 33R-2375, is also available for use as a blocking control in assays to test for specificity of this ALAD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALAD

Target: ALAD (Aminolevulinate Dehydratase (ALAD))

Andere Bezeichnung: ALAD (ALAD Produkte)

Synonyme: DDBDRAFT_0190269 antikoerper, DDBDRAFT_0231415 antikoerper, DDB_0190269 antikoerper, DDB_0231415 antikoerper, ALAD antikoerper, ncf antikoerper, ALADH antikoerper, PBGS antikoerper, ALADR antikoerper, aminolevulinatedelta-dehydratase antikoerper, zgc:110219 antikoerper, Lv antikoerper, delta-aminolevulinate dehydratase antikoerper, aminolevulinate dehydratase antikoerper, delta-aminolevulinic acid dehydratase antikoerper, Delta-aminolevulinic acid dehydratase antikoerper, aminolevulinate dehydratase L homeolog antikoerper, aminolevulinate, delta-, dehydratase antikoerper, hemB antikoerper, ALAD antikoerper, PBGS antikoerper, STY0404 antikoerper, SAS1597 antikoerper, SACI_RS03725 antikoerper, PAAG_00299 antikoerper, VDBG_00315 antikoerper, HPPC_00830 antikoerper, MGYG_01952 antikoerper, hem2 antikoerper, alad.L antikoerper, Alad antikoerper, alad antikoerper

Hintergrund: The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway, zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.

Molekulargewicht: 39 kDa (MW of target protein)