AKAP10 Antikörper

Produktnummer ABIN632020

Produktdetails anti-AKAP10 Antikörper

Target: AKAP10 (A Kinase (PRKA) Anchor Protein 10 (AKAP10))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AKAP10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: AKAP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AKAP10 Blocking Peptide, catalog no. 33R-2735, is also available for use as a blocking control in assays to test for specificity of this AKAP10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AKAP10

Target: AKAP10 (A Kinase (PRKA) Anchor Protein 10 (AKAP10))

Andere Bezeichnung: AKAP10 (AKAP10 Produkte)

Synonyme: MGC84612 antikoerper, AKAP10 antikoerper, fc10g11 antikoerper, wu:fc10g11 antikoerper, si:dkey-197m14.4 antikoerper, AKAP-10 antikoerper, D-AKAP-2 antikoerper, D-AKAP2 antikoerper, PRKA10 antikoerper, 1500031L16Rik antikoerper, B130049N18Rik antikoerper, D-akap2 antikoerper, Akap10 antikoerper, A-kinase anchoring protein 10 antikoerper, A-kinase anchoring protein 10 L homeolog antikoerper, A kinase (PRKA) anchor protein 10 antikoerper, AKAP10 antikoerper, akap10.L antikoerper, akap10 antikoerper, Akap10 antikoerper

Hintergrund: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA, therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction.

Molekulargewicht: 71 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling