RAB40C Antikörper (N-Term)

Produktnummer ABIN632024

Produktdetails anti-RAB40C Antikörper

Target: RAB40C (RAB40C, Member RAS Oncogene Family (RAB40C))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB40C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAB40 C antibody was raised against the N terminal of RAB40

Aufreinigung: Affinity purified

Immunogen: RAB40 C antibody was raised using the N terminal of RAB40 corresponding to a region with amino acids QDGAAESPYAYSNGIDYKTTTILLDGRRVRLELWDTSGQGRFCTIFRSYS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB40C Blocking Peptide, catalog no. 33R-7497, is also available for use as a blocking control in assays to test for specificity of this RAB40C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB40C

Target: RAB40C (RAB40C, Member RAS Oncogene Family (RAB40C))

Andere Bezeichnung: RAB40C (RAB40C Produkte)

Synonyme: RAB40C antikoerper, cb453 antikoerper, wu:fk50d06 antikoerper, zgc:136966 antikoerper, RARL antikoerper, RASL8C antikoerper, RAR3 antikoerper, Rab40c, member RAS oncogene family antikoerper, RAB40C, member RAS oncogene family antikoerper, RAB40c, member RAS oncogene family antikoerper, Rab40C, member RAS oncogene family antikoerper, Rab40c antikoerper, RAB40C antikoerper, rab40c antikoerper

Hintergrund: RAB40C is a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Molekulargewicht: 31 kDa (MW of target protein)