MAT2B Antikörper (Middle Region)
-
- Target Alle MAT2B Antikörper anzeigen
- MAT2B (Methionine Adenosyltransferase II, beta (MAT2B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAT2B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAT2 B antibody was raised against the middle region of MAT2
- Aufreinigung
- Affinity purified
- Immunogen
- MAT2 B antibody was raised using the middle region of MAT2 corresponding to a region with amino acids GNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGE
- Top Product
- Discover our top product MAT2B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAT2B Blocking Peptide, catalog no. 33R-3451, is also available for use as a blocking control in assays to test for specificity of this MAT2B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAT2B (Methionine Adenosyltransferase II, beta (MAT2B))
- Andere Bezeichnung
- MAT2B (MAT2B Produkte)
- Synonyme
- MAT-II antikoerper, MATIIbeta antikoerper, Nbla02999 antikoerper, SDR23E1 antikoerper, TGR antikoerper, 1110064C04Rik antikoerper, 2410018D16Rik antikoerper, AI182287 antikoerper, AU022853 antikoerper, fc55d01 antikoerper, wu:fb48h02 antikoerper, wu:fc55d01 antikoerper, zgc:110308 antikoerper, MAT2beta antikoerper, methionine adenosyltransferase 2B antikoerper, methionine adenosyltransferase II, beta antikoerper, methionine adenosyltransferase II, beta L homeolog antikoerper, MAT2B antikoerper, Mat2b antikoerper, mat2b antikoerper, mat2b.L antikoerper
- Hintergrund
- MAT2B belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process, SARS-CoV-2 Protein Interaktom
-