C11orf54 Antikörper (N-Term)

Produktnummer ABIN632029

Produktdetails anti-C11orf54 Antikörper

Target: C11orf54 (Chromosome 11 Open Reading Frame 54 (C11orf54))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C11orf54 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C11 ORF54 antibody was raised against the N terminal Of C11 rf54

Aufreinigung: Affinity purified

Immunogen: C11 ORF54 antibody was raised using the N terminal Of C11 rf54 corresponding to a region with amino acids CPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C11ORF54 Blocking Peptide, catalog no. 33R-1759, is also available for use as a blocking control in assays to test for specificity of this C11ORF54 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF54 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C11orf54

Target: C11orf54 (Chromosome 11 Open Reading Frame 54 (C11orf54))

Andere Bezeichnung: C11ORF54 (C11orf54 Produkte)

Synonyme: PTD012 antikoerper, C11orf54 antikoerper, fb58g01 antikoerper, wu:fb58g01 antikoerper, wu:fc54a08 antikoerper, chromosome 11 open reading frame 54 antikoerper, chromosome 29 open reading frame, human C11orf54 antikoerper, chromosome 1 open reading frame, human C11orf54 antikoerper, chromosome 11 open reading frame 54 L homeolog antikoerper, RIKEN cDNA 4931406C07 gene antikoerper, zgc:85789 antikoerper, C11orf54 antikoerper, C29H11orf54 antikoerper, C1H11ORF54 antikoerper, c11orf54.L antikoerper, c11orf54 antikoerper, 4931406C07Rik antikoerper, zgc:85789 antikoerper

Hintergrund: C11orf54 exhibits ester hydrolase activity on the substrate p-nitrophenyl acetate.

Molekulargewicht: 29 kDa (MW of target protein)