ALDH1L1 Antikörper (Middle Region)
-
- Target Alle ALDH1L1 Antikörper anzeigen
- ALDH1L1 (Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALDH1L1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ALDH1 L1 antibody was raised against the middle region of ALDH1 1
- Aufreinigung
- Affinity purified
- Immunogen
- ALDH1 L1 antibody was raised using the middle region of ALDH1 1 corresponding to a region with amino acids LTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKS
- Top Product
- Discover our top product ALDH1L1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALDH1L1 Blocking Peptide, catalog no. 33R-5480, is also available for use as a blocking control in assays to test for specificity of this ALDH1L1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALDH1L1 (Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1))
- Andere Bezeichnung
- ALDH1L1 (ALDH1L1 Produkte)
- Synonyme
- 10-FTHFDH antikoerper, 10-fTHF antikoerper, FDH antikoerper, FTHFD antikoerper, Fthfd antikoerper, 1810048F20Rik antikoerper, Neut2 antikoerper, fthfd antikoerper, ALDH1L1 antikoerper, DKFZp469C068 antikoerper, aldehyde dehydrogenase 1 family member L1 antikoerper, aldehyde dehydrogenase 1 family, member L1 antikoerper, cytosolic 10-formyltetrahydrofolate dehydrogenase antikoerper, aldehyde dehydrogenase 1 family member L1 L homeolog antikoerper, ALDH1L1 antikoerper, Aldh1l1 antikoerper, aldh1l1 antikoerper, LOC476506 antikoerper, LOC100465263 antikoerper, aldh1l1.L antikoerper
- Hintergrund
- ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.
- Molekulargewicht
- 99 kDa (MW of target protein)
-