ANKS3 Antikörper (N-Term)

Produktnummer ABIN632034

Produktdetails anti-ANKS3 Antikörper

Target: ANKS3 (Ankyrin Repeat and SAM Domain-Containing Protein 3 (ANKS3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANKS3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ANKS3 antibody was raised against the N terminal of ANKS3

Aufreinigung: Affinity purified

Immunogen: ANKS3 antibody was raised using the N terminal of ANKS3 corresponding to a region with amino acids WHGLGTQVSGEELDVPLDLHTAASIGQYEVVKECVQRRELDLNKKNGGGW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANKS3 Blocking Peptide, catalog no. 33R-9953, is also available for use as a blocking control in assays to test for specificity of this ANKS3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKS3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANKS3

Target: ANKS3 (Ankyrin Repeat and SAM Domain-Containing Protein 3 (ANKS3))

Andere Bezeichnung: ANKS3 (ANKS3 Produkte)

Synonyme: 2700067D09Rik antikoerper, C81345 antikoerper, mKIAA1977 antikoerper, RGD1305833 antikoerper, ankyrin repeat and sterile alpha motif domain containing 3 antikoerper, anks3 antikoerper, ANKS3 antikoerper, Anks3 antikoerper

Hintergrund: ANKS3 contains 1 SAM (sterile alpha motif) domain and 6 ANK repeats. The exact function of ANKS3 remains unknown.

Molekulargewicht: 72 kDa (MW of target protein)