FAM13C Antikörper (N-Term)

Produktnummer ABIN632036

Produktdetails anti-FAM13C Antikörper

Target: FAM13C (Family with Sequence Similarity 13, Member C (FAM13C))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM13C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM13 C1 antibody was raised against the N terminal of FAM13 1

Aufreinigung: Affinity purified

Immunogen: FAM13 C1 antibody was raised using the N terminal of FAM13 1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM13C1 Blocking Peptide, catalog no. 33R-9039, is also available for use as a blocking control in assays to test for specificity of this FAM13C1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM10 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM13C

Target: FAM13C (Family with Sequence Similarity 13, Member C (FAM13C))

Andere Bezeichnung: FAM13C1 (FAM13C Produkte)

Synonyme: FAM13C1 antikoerper, Fam13c1 antikoerper, RGD1310149 antikoerper, 1200015N20Rik antikoerper, C030038O19Rik antikoerper, mKIAA1796 antikoerper, family with sequence similarity 13 member C antikoerper, family with sequence similarity 13, member C antikoerper, FAM13C antikoerper, Fam13c antikoerper

Hintergrund: FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.

Molekulargewicht: 55 kDa (MW of target protein)