KIF5C Antikörper (N-Term)

Produktnummer ABIN632038

Produktdetails anti-KIF5C Antikörper

Target: KIF5C (Kinesin Family Member 5C (KIF5C))

Bindungsspezifität: N-Term

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF5C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIF5 C antibody was raised against the N terminal of KIF5

Aufreinigung: Affinity purified

Immunogen: KIF5 C antibody was raised using the N terminal of KIF5 corresponding to a region with amino acids TVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF5C Blocking Peptide, catalog no. 33R-9375, is also available for use as a blocking control in assays to test for specificity of this KIF5C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF5C

Target: KIF5C (Kinesin Family Member 5C (KIF5C))

Andere Bezeichnung: KIF5C (KIF5C Produkte)

Synonyme: KIF5C antikoerper, LOC100218538 antikoerper, KINN antikoerper, NKHC antikoerper, NKHC-2 antikoerper, NKHC2 antikoerper, Khc antikoerper, si:ch211-157c24.3 antikoerper, kinesin family member 5C antikoerper, KIF5C antikoerper, kif5c antikoerper, Kif5c antikoerper

Hintergrund: KIF5C belongs to the kinesin-like protein family, Kinesin subfamily. It contains 1 kinesin-motor domain. Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.

Molekulargewicht: 109 kDa (MW of target protein)