ACBD7 Antikörper (N-Term)
-
- Target Alle ACBD7 Antikörper anzeigen
- ACBD7 (Acyl-CoA Binding Domain Containing 7 (ACBD7))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACBD7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACBD7 antibody was raised against the N terminal of ACBD7
- Aufreinigung
- Affinity purified
- Immunogen
- ACBD7 antibody was raised using the N terminal of ACBD7 corresponding to a region with amino acids MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD
- Top Product
- Discover our top product ACBD7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACBD7 Blocking Peptide, catalog no. 33R-5696, is also available for use as a blocking control in assays to test for specificity of this ACBD7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACBD7 (Acyl-CoA Binding Domain Containing 7 (ACBD7))
- Andere Bezeichnung
- ACBD7 (ACBD7 Produkte)
- Synonyme
- zgc:114176 antikoerper, bA455B2.2 antikoerper, RGD1564164 antikoerper, 9230116B18Rik antikoerper, acyl-CoA binding domain containing 7 antikoerper, acyl-CoA binding domain containing 7 L homeolog antikoerper, acyl-Coenzyme A binding domain containing 7 antikoerper, ACBD7 antikoerper, acbd7 antikoerper, acbd7.L antikoerper, Acbd7 antikoerper
- Hintergrund
- The function of ACBD7 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 10 kDa (MW of target protein)
-