Phosphoglucomutase 1 Antikörper (Middle Region)
-
- Target Alle Phosphoglucomutase 1 (PGM1) Antikörper anzeigen
- Phosphoglucomutase 1 (PGM1)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Phosphoglucomutase 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PGM1 antibody was raised against the middle region of PGM1
- Aufreinigung
- Affinity purified
- Immunogen
- PGM1 antibody was raised using the middle region of PGM1 corresponding to a region with amino acids ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI
- Top Product
- Discover our top product PGM1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PGM1 Blocking Peptide, catalog no. 33R-1559, is also available for use as a blocking control in assays to test for specificity of this PGM1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Phosphoglucomutase 1 (PGM1)
- Andere Bezeichnung
- PGM1 (PGM1 Produkte)
- Synonyme
- CDG1T antikoerper, GSD14 antikoerper, ARABIDOPSIS THALIANA PHOSPHOGLUCOMUTASE antikoerper, ATPGMP antikoerper, MIO24.4 antikoerper, MIO24_4 antikoerper, PGM1 antikoerper, PHOSPHOGLUCOMUTASE antikoerper, STARCH-FREE 1 antikoerper, STF1 antikoerper, phosphoglucomutase antikoerper, PSPTO3035 antikoerper, CMS0426 antikoerper, 3230402E02Rik antikoerper, Pgm-1 antikoerper, Pgm2 antikoerper, zgc:63718 antikoerper, phosphoglucomutase-1 antikoerper, pgm2 antikoerper, PGM antikoerper, PGM 1 antikoerper, phosphoglucomutase 1 antikoerper, hypothetical protein antikoerper, phosphoglucomutase antikoerper, phosphoglucomutase alpha-D-glucose phosphate-specific Pgm antikoerper, phosphoglucomutase, alpha-D-glucose phosphate-specific antikoerper, phosphoglucomutase 1 L homeolog antikoerper, PGM1 antikoerper, R05F9.6 antikoerper, PGM antikoerper, pgm antikoerper, STY0736 antikoerper, PMI_RS02700 antikoerper, Pgm1 antikoerper, pgm1 antikoerper, LOC542721 antikoerper, pgm1.L antikoerper
- Hintergrund
- PGM1 is an isozyme of phosphoglucomutase (PGM) and belongs to the phosphohexose mutase family. There are several PGM isozymes, which are encoded by different genes and catalyze the transfer of phosphate between the 1 and 6 positions of glucose.
- Molekulargewicht
- 61 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process
-