EFHA2 Antikörper (N-Term)
-
- Target Alle EFHA2 (MICU3) Produkte
- EFHA2 (MICU3) (Mitochondrial Calcium Uptake Family, Member 3 (MICU3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EFHA2 Antikörper ist unkonjugiert
- Applikation
- Western Blotting (WB)
- Spezifität
- EFHA2 antibody was raised against the N terminal of EFHA2
- Aufreinigung
- Affinity purified
- Immunogen
- EFHA2 antibody was raised using the N terminal of EFHA2 corresponding to a region with amino acids TLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQ
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EFHA2 Blocking Peptide, catalog no. 33R-9171, is also available for use as a blocking control in assays to test for specificity of this EFHA2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFHA2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EFHA2 (MICU3) (Mitochondrial Calcium Uptake Family, Member 3 (MICU3))
- Andere Bezeichnung
- EFHA2 (MICU3 Produkte)
- Hintergrund
- The function of EFHA protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 61 kDa (MW of target protein)
-