Ubiquilin 1 Antikörper (Middle Region)
-
- Target Alle Ubiquilin 1 (UBQLN1) Antikörper anzeigen
- Ubiquilin 1 (UBQLN1)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Ubiquilin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Ubiquilin 1 antibody was raised against the middle region of UBQLN1
- Aufreinigung
- Affinity purified
- Immunogen
- Ubiquilin 1 antibody was raised using the middle region of UBQLN1 corresponding to a region with amino acids QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA
- Top Product
- Discover our top product UBQLN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Ubiquilin 1 Blocking Peptide, catalog no. 33R-7544, is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBQLN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Ubiquilin 1 (UBQLN1)
- Andere Bezeichnung
- Ubiquilin 1 (UBQLN1 Produkte)
- Synonyme
- UBQLN1 antikoerper, DA41 antikoerper, DSK2 antikoerper, PLIC-1 antikoerper, UBQN antikoerper, XDRP1 antikoerper, 1110046H03Rik antikoerper, 1810030E05Rik antikoerper, AU019746 antikoerper, C77538 antikoerper, D13Ertd372e antikoerper, Da41 antikoerper, Dsk2 antikoerper, Plic-1 antikoerper, Plic1 antikoerper, Xdrp1 antikoerper, ubiquilin 1 antikoerper, UBQLN1 antikoerper, Ubqln1 antikoerper
- Hintergrund
- UBQLN1 is an ubiquitin-like protein (ubiquilin) that shares a high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain an N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.
- Molekulargewicht
- 62 kDa (MW of target protein)
-