DCUN1D1 Antikörper
-
- Target Alle DCUN1D1 Antikörper anzeigen
- DCUN1D1 (Defective in Cullin Neddylation 1, Domain Containing 1 (DCUN1D1))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DCUN1D1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- DCUN1 D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK
- Top Product
- Discover our top product DCUN1D1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DCUN1D1 Blocking Peptide, catalog no. 33R-8719, is also available for use as a blocking control in assays to test for specificity of this DCUN1D1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCUN0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DCUN1D1 (Defective in Cullin Neddylation 1, Domain Containing 1 (DCUN1D1))
- Andere Bezeichnung
- DCUN1D1 (DCUN1D1 Produkte)
- Hintergrund
- DCUN1D1 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
- Molekulargewicht
- 28 kDa (MW of target protein)
-