DCUN1D1 Antikörper

Produktnummer ABIN632052

Produktdetails anti-DCUN1D1 Antikörper

Target: DCUN1D1 (Defective in Cullin Neddylation 1, Domain Containing 1 (DCUN1D1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DCUN1D1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: DCUN1 D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DCUN1D1 Blocking Peptide, catalog no. 33R-8719, is also available for use as a blocking control in assays to test for specificity of this DCUN1D1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCUN0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DCUN1D1

Target: DCUN1D1 (Defective in Cullin Neddylation 1, Domain Containing 1 (DCUN1D1))

Andere Bezeichnung: DCUN1D1 (DCUN1D1 Produkte)

Synonyme: fd19a01 antikoerper, zgc:66414 antikoerper, wu:fd19a01 antikoerper, dcun1l1 antikoerper, rp42 antikoerper, sccro antikoerper, scro antikoerper, tes3 antikoerper, DCNL1 antikoerper, DCUN1L1 antikoerper, RP42 antikoerper, SCCRO antikoerper, SCRO antikoerper, Tes3 antikoerper, Rp42 antikoerper, pTes3 antikoerper, DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) antikoerper, DCN1-like protein 1 antikoerper, DCN1, defective in cullin neddylation 1, domain containing 1 L homeolog antikoerper, defective in cullin neddylation 1 domain containing 1 antikoerper, dcun1d1 antikoerper, dcnl1 antikoerper, dcun1d1.L antikoerper, DCUN1D1 antikoerper, Dcun1d1 antikoerper

Hintergrund: DCUN1D1 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.

Molekulargewicht: 28 kDa (MW of target protein)