Schlafen-Like 1 Antikörper (Middle Region)
-
- Target Alle Schlafen-Like 1 (SLFNL1) Produkte
- Schlafen-Like 1 (SLFNL1)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Schlafen-Like 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLFNL1 antibody was raised against the middle region of SLFNL1
- Aufreinigung
- Affinity purified
- Immunogen
- SLFNL1 antibody was raised using the middle region of SLFNL1 corresponding to a region with amino acids TVHTPKAQSQPQLYQTDQGEVFLRRDGSIQGPLSASAIQEWCRQRWLVEL
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLFNL1 Blocking Peptide, catalog no. 33R-9355, is also available for use as a blocking control in assays to test for specificity of this SLFNL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLFNL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Schlafen-Like 1 (SLFNL1)
- Andere Bezeichnung
- SLFNL1 (SLFNL1 Produkte)
- Synonyme
- 4933406A14Rik antikoerper, schlafen like 1 antikoerper, schlafen-like 1 antikoerper, SLFNL1 antikoerper, Slfnl1 antikoerper
- Hintergrund
- SLFNL1 belongs to the Schlafen family. The function of the SLFNL1 protein remains unknown.
- Molekulargewicht
- 45 kDa (MW of target protein)
-