IPPK Antikörper (Middle Region)
-
- Target Alle IPPK Antikörper anzeigen
- IPPK (Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase (IPPK))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IPPK Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IPPK antibody was raised against the middle region of IPPK
- Aufreinigung
- Affinity purified
- Immunogen
- IPPK antibody was raised using the middle region of IPPK corresponding to a region with amino acids KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK
- Top Product
- Discover our top product IPPK Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IPPK Blocking Peptide, catalog no. 33R-4685, is also available for use as a blocking control in assays to test for specificity of this IPPK antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IPPK antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IPPK (Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase (IPPK))
- Andere Bezeichnung
- IPPK (IPPK Produkte)
- Synonyme
- IPPK antikoerper, MGC146756 antikoerper, C9orf12 antikoerper, INSP5K2 antikoerper, IP5K antikoerper, IPK1 antikoerper, bA476B13.1 antikoerper, 1810043M15Rik antikoerper, InsP6 antikoerper, RGD1311271 antikoerper, rIpk1 antikoerper, ipk1 antikoerper, ipk1l antikoerper, si:dkey-42i9.3 antikoerper, zgc:110769 antikoerper, ATIPK1 antikoerper, M40H3 antikoerper, MJB21.19 antikoerper, MJB21_19 antikoerper, inositol-pentakisphosphate 2-kinase 1 antikoerper, inositol-pentakisphosphate 2-kinase antikoerper, inositol 1,3,4,5,6-pentakisphosphate 2-kinase antikoerper, inositol pentakisphosphate 2-kinase antikoerper, inositol-pentakisphosphate 2-kinase 1 antikoerper, IPPK antikoerper, LOC521083 antikoerper, ippk antikoerper, Ippk antikoerper, IPK1 antikoerper
- Hintergrund
- IPPK phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate). InsP6 is involved in many processes such as mRNA export, non-homologous end-joining, endocytosis, ion channel regulation. It also protects cells from TNF-alpha-induced apoptosis.
- Molekulargewicht
- 56 kDa (MW of target protein)
-