PLS1 Antikörper
-
- Target Alle PLS1 Antikörper anzeigen
- PLS1 (Plastin 1 (PLS1))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Plastin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY
- Top Product
- Discover our top product PLS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Plastin 1 Blocking Peptide, catalog no. 33R-4152, is also available for use as a blocking control in assays to test for specificity of this Plastin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLS1 (Plastin 1 (PLS1))
- Andere Bezeichnung
- Plastin 1 (PLS1 Produkte)
- Synonyme
- i-plastin antikoerper, DKFZp459F2151 antikoerper, Plastin-1 antikoerper, wu:fi38g03 antikoerper, zgc:63494 antikoerper, AI427122 antikoerper, plastin 1 antikoerper, plastin 1 (I isoform) antikoerper, plastin 1 (I-isoform) antikoerper, PLS1 antikoerper, pls1 antikoerper, Pls1 antikoerper
- Hintergrund
- Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified.
- Molekulargewicht
- 70 kDa (MW of target protein)
-