TPRG1 Antikörper (N-Term)
-
- Target Alle TPRG1 Produkte
- TPRG1 (Tumor Protein P63 Regulated 1 (TPRG1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TPRG1 Antikörper ist unkonjugiert
- Applikation
- Western Blotting (WB)
- Spezifität
- FAM79 B antibody was raised against the N terminal Of Fam79
- Aufreinigung
- Affinity purified
- Immunogen
- FAM79 B antibody was raised using the N terminal Of Fam79 corresponding to a region with amino acids DPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGH
-
anti-Tumor Protein P63 Regulated 1 (TPRG1) (C-Term) antibody
TPRG1 Reaktivität: Human, Ratte, Hund, Meerschweinchen, Pferd, Kaninchen, Rind (Kuh), Maus, Fledermaus, Affe, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Tumor Protein P63 Regulated 1 (TPRG1) (AA 35-84) antibodyTPRG1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Tumor Protein P63 Regulated 1 (TPRG1) (C-Term) antibodyTPRG1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Tumor Protein P63 Regulated 1 (TPRG1) (N-Term) antibodyTPRG1 Reaktivität: Human, Ratte, Hund, Meerschweinchen, Pferd, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Tumor Protein P63 Regulated 1 (TPRG1) (C-Term) antibodyTPRG1 Reaktivität: Human, Ratte, Hund, Meerschweinchen, Pferd, Kaninchen, Rind (Kuh), Maus, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM79B Blocking Peptide, catalog no. 33R-2108, is also available for use as a blocking control in assays to test for specificity of this FAM79B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TPRG1 (Tumor Protein P63 Regulated 1 (TPRG1))
- Andere Bezeichnung
- FAM79B (TPRG1 Produkte)
- Synonyme
- Tprg antikoerper, Svap30 antikoerper, RGD1306226 antikoerper, MGC68514 antikoerper, MGC162933 antikoerper, zgc:162933 antikoerper, 5430420C16Rik antikoerper, Tprg1 antikoerper, FAM79B antikoerper, tumor protein p63 regulated 1 antikoerper, tumor protein p63 regulated 1 L homeolog antikoerper, transformation related protein 63 regulated antikoerper, Tprg1 antikoerper, tprg1.L antikoerper, TPRG1 antikoerper, tprg1 antikoerper, Tprg antikoerper
- Hintergrund
- The function of FAM79 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 31 kDa (MW of target protein)
-
