C16orf61 Antikörper (Middle Region)
-
- Target Alle C16orf61 Antikörper anzeigen
- C16orf61 (Chromosome 16 Open Reading Frame 61 (C16orf61))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C16orf61 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C16 ORF61 antibody was raised against the middle region of C16 rf61
- Aufreinigung
- Affinity purified
- Immunogen
- C16 ORF61 antibody was raised using the middle region of C16 rf61 corresponding to a region with amino acids NILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESE
- Top Product
- Discover our top product C16orf61 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C16ORF61 Blocking Peptide, catalog no. 33R-6726, is also available for use as a blocking control in assays to test for specificity of this C16ORF61 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF61 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C16orf61 (Chromosome 16 Open Reading Frame 61 (C16orf61))
- Andere Bezeichnung
- C16ORF61 (C16orf61 Produkte)
- Synonyme
- 1110046L09Rik antikoerper, 2310061C15Rik antikoerper, DC13 antikoerper, C16orf61 antikoerper, C18H16orf61 antikoerper, si:busm1-241h12.4 antikoerper, si:dz241h12.4 antikoerper, zgc:92271 antikoerper, C-x(9)-C motif containing 2 antikoerper, C-x(9)-C motif containing 2 S homeolog antikoerper, COX assembly mitochondrial protein 2 antikoerper, C-X9-C motif containing 2 antikoerper, cmc2 antikoerper, cmc2.S antikoerper, CMC2 antikoerper, Cmc2 antikoerper
- Hintergrund
- The function of Chromosome 16 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 9 kDa (MW of target protein)
-