SPACA7 Antikörper (Middle Region)

Produktnummer ABIN632089

Produktdetails anti-SPACA7 Antikörper

Target: SPACA7 (C13orf28) (Chromosome 13 Open Reading Frame 28 (C13orf28))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPACA7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C13 ORF28 antibody was raised against the middle region of C13 rf28

Aufreinigung: Affinity purified

Immunogen: C13 ORF28 antibody was raised using the middle region of C13 rf28 corresponding to a region with amino acids PGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C13ORF28 Blocking Peptide, catalog no. 33R-7105, is also available for use as a blocking control in assays to test for specificity of this C13ORF28 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF28 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPACA7

Target: SPACA7 (C13orf28) (Chromosome 13 Open Reading Frame 28 (C13orf28))

Andere Bezeichnung: C13ORF28 (C13orf28 Produkte)

Synonyme: C13orf28 antikoerper, 1700094C09Rik antikoerper, sperm acrosome associated 7 antikoerper, SPACA7 antikoerper, Spaca7 antikoerper

Hintergrund: The function of Chromosome 13 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 21 kDa (MW of target protein)